PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E03143.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 512aa    MW: 56139 Da    PI: 7.0812
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E03143.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.33.6e-1473112141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     k+kk+CnCk+s+Clk+YCeCfaag +C+  C+C++C N+ e
  Pahal.E03143.2  73 KKKKHCNCKNSQCLKLYCECFAAGDYCDG-CNCKQCGNTVE 112
                     589**************************.********987 PP

2TCR50.34.8e-16157196140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC dCkN e
  Pahal.E03143.2 157 KHNKGCHCKKSGCLKKYCECFQANILCSKNCKCMDCKNFE 196
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.8E-1473113IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.27674197IPR005172CRC domain
PfamPF036385.7E-1175110IPR005172CRC domain
SMARTSM011146.0E-19157198IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-12160195IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MEQEKQQRVE PQAPAPASVP QATSEPRASP QPQEQPKPAV PVQPSIPVTR PWPMAIIPSV  60
KPVVEMKSGT PAKKKKHCNC KNSQCLKLYC ECFAAGDYCD GCNCKQCGNT VENEKGRQEA  120
INNTKLRNPN AFQPKIENGP ITPSVRKDAG APPSLPKHNK GCHCKKSGCL KKYCECFQAN  180
ILCSKNCKCM DCKNFEGSEE LRAIIQGDNS CDRNNIQQAA NVALNGAIGS SGYRFSPVRR  240
KRPPEDPHYQ RLNVEGSMMQ MQFPEANHVD ASQIASSTGL EGSTGNFQGK SKLVYRSPLA  300
NTIHLTDVND LANRLVIVCR KAAEGVTAIA DNKEEREIDR EICTSTYQNF DENKKEVQKA  360
AASQLPEIDQ QIPVECGSYC SNTQEDSRPA SPGTRALLCD EQDLTFGTAY RSSIPVVLHD  420
QDISELQTAQ ENAVLREFRN YLRLIIARGQ VNEGKSSSGT GMELDAMRNH ESSTSLPPVR  480
AEEKSNDPDD PKNPNTSQSF ASDSVSTHVL E*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0617080.0BT061708.1 Zea mays full-length cDNA clone ZM_BFb0176J22 mRNA, complete cds.
GenBankKJ7280220.0KJ728022.1 Zea mays clone pUT6158 CPP transcription factor (CPP12) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965468.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLC5Z3600.0C5Z360_SORBI; Putative uncharacterized protein Sb10g019660
STRINGSb10g019660.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.14e-92Tesmin/TSO1-like CXC domain-containing protein